PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g018660.1.1
Common NameLOC101245609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 312aa    MW: 36056.1 Da    PI: 6.3467
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g018660.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.8e-5371351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++      ++ee+ewyfFs++d+ky+tg+r+nrat +g+Wkatg+
  Solyc11g018660.1.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRMEPWDIQDrckLGYEEESEWYFFSHKDRKYPTGTRTNRATGAGFWKATGR 96 
                         69****************************.9***************952422233667******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+vls k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  Solyc11g018660.1.1  97 DKAVLS-KEKIIGMRKTLVFYRGRAPNGRKSDWIMHEYRL 135
                         ******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-605156IPR003441NAC domain
PROSITE profilePS5100558.457156IPR003441NAC domain
PfamPF023652.3E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEIESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRMEPW DIQDRCKLGY  60
EEESEWYFFS HKDRKYPTGT RTNRATGAGF WKATGRDKAV LSKEKIIGMR KTLVFYRGRA  120
PNGRKSDWIM HEYRLQTSQH GPPQEEGWVV CRAFKKPSPS NNNYYMRGTN TSYSTRPPPS  180
LSQMPSYYIT NINPLNQTSN FNHQFPLNHQ ISSQNNIGYD NNQLLIHELP QLDSPTTIST  240
SLATNDHQGQ NSINNNNNED QFCDEWSVDD KLFAPQVMEA PSSSSYSYPN FLLDGNDQNH  300
MSQLLHCYPD L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-50716217171NO APICAL MERISTEM PROTEIN
1ut4_B6e-50716217171NO APICAL MERISTEM PROTEIN
1ut7_A6e-50716217171NO APICAL MERISTEM PROTEIN
1ut7_B6e-50716217171NO APICAL MERISTEM PROTEIN
3swm_A7e-50716220174NAC domain-containing protein 19
3swm_B7e-50716220174NAC domain-containing protein 19
3swm_C7e-50716220174NAC domain-containing protein 19
3swm_D7e-50716220174NAC domain-containing protein 19
3swp_A7e-507